DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gst-43

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:184 Identity:56/184 - (30%)
Similarity:87/184 - (47%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRGSGCRTVIMVAKAL-GVKLNMKLLNTL-EKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRA 67
            ||...|.|...:.:|.|| .:....:.::.. |:.:...||||.||...:||||.||.|:.||.|
 Worm     7 YSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLSLTESLA 71

  Fly    68 IAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDF---KK 129
            |..||.|.| .|....||:..|::.........:.::....|...:.:.:..:||.. ||   ..
 Worm    72 IIEYLDEAY-PDPPFLPKELDKRSYSRAIALHIVASIQPLQAINIHKMLNEKEPGYG-DFWCNHF 134

  Fly   130 IESSFEYLNIFLEGQN--YVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVAR 181
            :...|..|...|:..:  |..||.||:|||.:.|.:...:|:..|::|||.:.|
 Worm   135 VNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIYKVDMSKYPTITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 56/184 (30%)
GST_N_Delta_Epsilon 1..74 CDD:239343 27/70 (39%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/99 (24%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 26/69 (38%)
maiA 5..211 CDD:273527 56/184 (30%)
GST_C_Zeta 90..207 CDD:198300 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163421
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.