DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gst-29

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_497118.1 Gene:gst-29 / 190225 WormBaseID:WBGene00001777 Length:209 Species:Caenorhabditis elegans


Alignment Length:163 Identity:46/163 - (28%)
Similarity:74/163 - (45%) Gaps:38/163 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDM 101
            ::||.:    .|...:|.|..:||.|.:|.||..||..|:|    ...|.|::||..:       
 Worm    42 EKLKDK----TPFGQVPVLYVDGFEIPQSAAIIRYLANKFG----YAGKTPEEQAWAD------- 91

  Fly   102 GTLYDSFAKYYYPLFH-------TGKPGSDEDFKKI---------ESSFEYLNIFLE--GQNYVA 148
             .:.|.| |.:..||.       .||  ||.:..|:         :|.||.:...||  ...::.
 Worm    92 -AIVDQF-KDFMSLFREFKLAQKAGK--SDVEIAKVASEVAIPARDSYFEIITNLLEKSKSGFLV 152

  Fly   149 GDHLTVADIAILSTVSTFE-IFDFDLNKYPNVA 180
            ||.||.|||.::.:::..| :..||.:::|.:|
 Worm   153 GDGLTFADIVVVESLTNLEKVHFFDASEHPKLA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 46/163 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/36 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/112 (26%)
gst-29NP_497118.1 GST_N_Sigma_like 4..74 CDD:239337 12/35 (34%)
PTZ00057 6..209 CDD:173353 46/163 (28%)
GST_C_Sigma_like 85..191 CDD:198301 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.