DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gst-27

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:182 Identity:46/182 - (25%)
Similarity:77/182 - (42%) Gaps:36/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRGSG--CRTVIMVAKALGVKLNMKLLN-TLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            |::.||.|  .|.:..:|........|.:.: |.|..:.|..|.:      .|.|..:||.|.:|
 Worm     8 YFNVRGYGEPARILFHLADVPFEDFRMTIGDGTWENLKAKTPFGQ------APVLSVDGFEIPQS 66

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPG----SDED 126
            .||..||.:::|    ...|.|::||..:        .:.|.:..:...:...||..    |.|:
 Worm    67 AAINRYLAKQFG----YAGKTPEEQAWTD--------AIVDQYKDFMVSIKEVGKASAAGKSAEE 119

  Fly   127 FKKI---------ESSFEYLNIFLE--GQNYVAGDHLTVADIAILSTVSTFE 167
            ..||         ::.|..:|..||  ...::.||.||:|||.|:..::|.:
 Worm   120 VGKIIQSDLVPARDAFFVIINKILEKSKSGFLVGDGLTIADIVIVECITTLD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 46/182 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/95 (23%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 21/72 (29%)
PTZ00057 6..208 CDD:173353 46/182 (25%)
GST_C_Sigma_like 85..191 CDD:198301 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.