DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Gstz1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:189 Identity:58/189 - (30%)
Similarity:87/189 - (46%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRGSGCRTVIMVAKAL-GVKLNMKLLNTLEKD---QLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ||...|.|...:.:|.|| |:...:..:| |.||   |...||..|||...:|.|..:|.:|.:|
Mouse     9 YSYFRSSCSWRVRIALALKGIDYEIVPIN-LIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQS 72

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTG---KPGSDEDF 127
            .||..|| |:......|.|:||:|:|:|..        :.|..|....||.:..   :.|.:...
Mouse    73 LAIMEYL-EETRPIPRLLPQDPQKRAIVRM--------ISDLIASGIQPLQNLSVLKQVGQENQM 128

  Fly   128 ----KKIESSFEYLNIFLEGQ--NYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVA 180
                |.|.|.|..|...|:..  .|..||.:::||:.::..|:..|.|..||:.||.::
Mouse   129 QWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTIS 187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 58/189 (31%)
GST_N_Delta_Epsilon 1..74 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/102 (25%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 27/72 (38%)
maiA 7..211 CDD:273527 58/189 (31%)
Glutathione binding 14..19 2/4 (50%)