DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and AIMP3

DIOPT Version :10

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_061501516.1 Gene:AIMP3 / 1275730 VectorBaseID:AGAMI1_003941 Length:180 Species:Anopheles gambiae


Alignment Length:69 Identity:17/69 - (24%)
Similarity:40/69 - (57%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTV--STFEIFDFDLNKYPNVARWYAN 185
            |::|....:|..:.||.:|:.::|:..|.|:|||:.:..|:  :...:...:...:.||:||:.:
Mosquito    86 SNKDKHTAKSLLDELNFYLQSRSYLVNDTLSVADVVVFHTIHETMANLQPLEKENFLNVSRWFHH 150

  Fly   186 AKKV 189
            .:::
Mosquito   151 LQQL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 17/69 (25%)
AIMP3XP_061501516.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.