DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and CLIC2

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:215 Identity:53/215 - (24%)
Similarity:90/215 - (41%) Gaps:68/215 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVK-LNPQHTIPTLVDNGFSIWESRAIAVYLVEK 75
            |:.:.|:....|||.|:..::...    |||.:| |.|....|.||.|.....:...|..:|   
Human    33 CQRLFMILWLKGVKFNVTTVDMTR----KPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFL--- 90

  Fly    76 YGKDDTLFPK-----DPK-KQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSD-------EDF 127
               :.||.|.     .|| |::       ||:|.  :.|||:...:.:|.|..:.       ::|
Human    91 ---EQTLAPPRYPHLSPKYKES-------FDVGC--NLFAKFSAYIKNTQKEANKNFEKSLLKEF 143

  Fly   128 KKIESSFEYLN--------------------IFLEGQNYVAGDHLTVADIAILSTVSTFEIF--- 169
            |:::   :|||                    :||:      ||.||:||.::|..::..::.   
Human   144 KRLD---DYLNTPLLDEIDPDSAEEPPVSRRLFLD------GDQLTLADCSLLPKLNIIKVAAKK 199

  Fly   170 --DFDL-NKYPNVARWYANA 186
              |||: .::..|.|:..||
Human   200 YRDFDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 51/211 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/62 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/133 (23%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 20/72 (28%)
N-terminal 1..94 18/70 (26%)
O-ClC 12..245 CDD:129941 53/215 (25%)
Joint loop 95..106 2/10 (20%)
C-terminal 107..247 30/131 (23%)
Foot loop 151..171 1/19 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.