DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and vars1

DIOPT Version :10

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:109 Identity:30/109 - (27%)
Similarity:51/109 - (46%) Gaps:16/109 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKIESS--FEYLNIF--LEG--- 143
            |.|:::.|.|.|.|....|........:||.  |..|.|   ||::.|  .|.|.:.  |:|   
Zfish    77 DKKQESQVWQWLSFAENELTPVACAVAFPLL--GIMGVD---KKLQQSSRAELLRVLKALDGTLA 136

  Fly   144 -QNYVAGDHLTVADIAI-LSTVSTFE--IFDFDLNKYPNVARWY 183
             :.::.|:.:|:||.|: ::.:..|:  :...|.....||.||:
Zfish   137 LRTFLVGESVTLADAAVAMAALLPFKYALEPADRKSLVNVTRWF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 29/107 (27%)
vars1NP_001298275.1 GST_C_ValRS_N 80..202 CDD:198327 28/106 (26%)
PTZ00419 291..1270 CDD:240411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.