DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gstz1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:182 Identity:54/182 - (29%)
Similarity:88/182 - (48%) Gaps:22/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGCRTVIMVAKAL-GVKLNMKLLNTLEKD---QLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAV 70
            |.|...:.:|.|. |::.:.:::| |.||   ||..|:.::||...:|.|..:|.::.:|.||..
 Frog    15 SSCSWRVRIALAFKGIEYDQQVIN-LVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQSLAIIE 78

  Fly    71 YLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFH---TGKPGSDE-DFKK-- 129
            || |:...:..|.|:||||:|.|..        :.|..|....||.:   ..|.|..: ::.|  
 Frog    79 YL-EETRPNPPLLPRDPKKRAQVRM--------ISDQIASGIQPLQNLCVLQKIGETKLEWAKHF 134

  Fly   130 IESSFEYLNIFLE--GQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNV 179
            |...|:.|...|:  ...|..||.:|:||:.::..|:....|..||..||.:
 Frog   135 ITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 54/182 (30%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/67 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/100 (27%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 54/182 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.