DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstD4 and grxB

DIOPT Version :9

Sequence 1:	NP_524913.1	Gene:	GstD4 / 48337	FlyBaseID:	FBgn0010040	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_415582.1	Gene:	grxB / 946926	ECOCYCID:	EG12688	Length:	215	Species:	Escherichia coli

Alignment Length:	53	Identity:	12/53 - (22%)
Similarity:	20/53 - (37%)	Gaps:	3/53 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   128 KKVEAAFEFLDIFLEGQDYV--AGSQLTVAD-IAILSSVSTFEVVEFDISKYP 177
            ||..:|..|.|:.......:  ....|...| :.:..:....|:.|.||..:|
E. coli   125 KKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFP 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstD4	NP_524913.1	PRK10542	1..184	CDD:182533	12/53 (23%)
		GST_N_Delta_Epsilon	1..74	CDD:239343
		GST_C_Delta_Epsilon	88..204	CDD:198287	12/53 (23%)
grxB	NP_415582.1	PRK10387	1..210	CDD:236679	12/53 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000035
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
	1	1.000