DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and grxB

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_415582.1 Gene:grxB / 946926 ECOCYCID:EG12688 Length:215 Species:Escherichia coli


Alignment Length:53 Identity:12/53 - (22%)
Similarity:20/53 - (37%) Gaps:3/53 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KKVEAAFEFLDIFLEGQDYV--AGSQLTVAD-IAILSSVSTFEVVEFDISKYP 177
            ||..:|..|.|:.......:  ....|...| :.:..:....|:.|.||..:|
E. coli   125 KKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 12/53 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 12/53 (23%)
grxBNP_415582.1 PRK10387 1..210 CDD:236679 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.