DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and yfcG

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_416805.1 Gene:yfcG / 946763 ECOCYCID:G7194 Length:215 Species:Escherichia coli


Alignment Length:203 Identity:51/203 - (25%)
Similarity:101/203 - (49%) Gaps:34/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRIT--EGEHLKPEFLKLNPQHTIPTLVDNG---- 59
            :|.|::|..:|.:..:.:.:|   ||:.:.:::.  :|...:||||:::|.:.||.:||:.    
E. coli     2 IDLYFAPTPNGHKITLFLEEA---ELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADG 63

  Fly    60 ---FAIWESRAIAVYLVEKYGKDDSLF-PNDPQKRALINQRLYFDMGTLHDSFMKYYY------- 113
               .:::||.||.:||.||.|    || .::.::||...|.|::.:|.|.....:.::       
E. coli    64 GEPLSLFESGAILLYLAEKTG----LFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNHAAPQ 124

  Fly   114 --PFIRTGQLGNAENYK-KVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISK 175
              |:.       .|.|: :.:..:..|:..||...::.|...::||||....|:.:.....|::.
E. coli   125 TIPYA-------IERYQVETQRLYHVLNKRLENSPWLGGENYSIADIACWPWVNAWTRQRIDLAM 182

  Fly   176 YPNVARWY 183
            ||.|..|:
E. coli   183 YPAVKNWH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 51/203 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/81 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/106 (22%)
yfcGNP_416805.1 PRK13972 1..215 CDD:172475 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I389
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
76.760

Return to query results.
Submit another query.