DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and sspA

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:148 Identity:40/148 - (27%)
Similarity:62/148 - (41%) Gaps:22/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKD 79
            |::..|.:..|:..     .|.::...:.:.|||..::|||||....:||||.|..||.|:: ..
E. coli    27 IVLAEKGVSFEIEH-----VEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERF-PH 85

  Fly    80 DSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRT---GQLGNAENYKKV--EAAFEFLDI 139
            ..|.|..|..|.  ..|||     :| ...|.:|..:.|   |....|:..:|.  |.......:
E. coli    86 PPLMPVYPVARG--ESRLY-----MH-RIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPV 142

  Fly   140 FLEGQ-DYVAGSQLTVAD 156
            |  || .|....:.::.|
E. coli   143 F--GQKPYFLSDEFSLVD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 40/148 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/58 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 17/75 (23%)
sspANP_417696.1 sspA 1..211 CDD:236537 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I719
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.