DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTO1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:210 Identity:55/210 - (26%)
Similarity:95/210 - (45%) Gaps:44/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MVAKALG-----LELNKKQLRITEGEHLKPE-FLKLNPQHTIPTLVDN-GFAIWESRAIAVYLVE 74
            :|.||.|     :.:|.|.         ||| |.|.||...:|.|.:: |..|:||.....||.|
Human    40 LVLKAKGIRHEVININLKN---------KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDE 95

  Fly    75 KY-GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAF--EF 136
            .| ||  .|.|:||.::|.  |::..::.:...|.:.   .|||:   .|.|:|..::..|  ||
Human    96 AYPGK--KLLPDDPYEKAC--QKMILELFSKVPSLVG---SFIRS---QNKEDYAGLKEEFRKEF 150

  Fly   137 --LDIFLEGQ--DYVAGSQLTVADIAILSSVSTFEVVEFD--ISKYPNVARWYANAKK------- 188
              |:..|..:  .:..|:.:::.|..|.......|.::.:  :...|.:..|.|..|:       
Human   151 TKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSAL 215

  Fly   189 ITPGWDENWKGLLQM 203
            :|.  :::|:|.|::
Human   216 LTS--EKDWQGFLEL 228

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 49/182 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/63 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/131 (20%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 20/62 (32%)