DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and CAM1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:48/212 - (22%)
Similarity:90/212 - (42%) Gaps:56/212 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLV-DNGFAIWESRAIAVYLVEKYGKDDS 81
            :.|||.|:     :::...:....:|.:..|...:|..| ..|:.:.|:.||..||| |..:||.
Yeast    20 LVKALKLD-----VKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKLTEAMAINYYLV-KLSQDDK 78

  Fly    82 LFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAE------------------NYK 128
            :      |..|:..          |..:......||...|.|::                  |.|
Yeast    79 M------KTQLLGA----------DDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKK 127

  Fly   129 KVEAAFE----FLDIF---LEGQDYVAGSQLTVADIAILSSVST--FEVV---EFDISKYPNVAR 181
            .|::|.:    .:|||   |:...|:|...:::||: :.:|:.|  ||.:   |:. :::|.:.|
Yeast   128 SVDSAMDAVDKIVDIFENRLKNYTYLATENISLADL-VAASIFTRYFESLFGTEWR-AQHPAIVR 190

  Fly   182 WYANAKKITPGWDENWK 198
            |: |..:.:|...:.:|
Yeast   191 WF-NTVRASPFLKDEYK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 45/196 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/56 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/141 (21%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 15/58 (26%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 27/118 (23%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.