DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and URE2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:59/229 - (25%)
Similarity:103/229 - (44%) Gaps:59/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRS--SGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNG---FAIWE 64
            :|.||  :|.:..|:::: ||...|...|....|||..|||:.:||...:|.|:|:|   .:|||
Yeast   117 FSHRSAPNGFKVAIVLSE-LGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE 180

  Fly    65 SRAIAVYLVEKYGKDDS---LFPNDPQKRALINQRLYFDMG--------TLHDSFMKYYYPFIRT 118
            |.||.::||.||.|:..   |:.:|...::.||..|:|...        .||   .:|::    :
Yeast   181 SGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALH---FRYFH----S 238

  Fly   119 GQLGNA-ENY----------------KKVEAAFEFLDI-----------------FLEGQDYVAG 149
            .::.:| |.|                ::.||....||.                 |.:...::.|
Yeast   239 QKIASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVG 303

  Fly   150 SQLTVADIAILSSVSTFEVVEFDIS-KYPNVARW 182
            .:||:||:|.:...:..:.:..:|. ::|.|.:|
Yeast   304 DKLTIADLAFVPWNNVVDRIGINIKIEFPEVYKW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 59/229 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 28/73 (38%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/138 (18%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 31/77 (40%)
GST_C_Ure2p 208..350 CDD:198326 25/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2827
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.