DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and TEF4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:47/208 - (22%)
Similarity:79/208 - (37%) Gaps:59/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPT-LVDNGFAIWESRAIA 69
            |||:..|..:|...|.        .::|.:.|. ..||..|.|....|. |...|..:.|:.||.
Yeast    11 SPRNYASEALISYFKL--------DVKIVDLEQ-SSEFASLFPLKQAPAFLGPKGLKLTEALAIQ 66

  Fly    70 VYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAE--------- 125
            .||..:..        |.::||.:       :|:  |...|  ...:|...|.|::         
Yeast    67 FYLANQVA--------DEKERARL-------LGS--DVIEK--SQILRWASLANSDVMSNIARPF 112

  Fly   126 ---------NYKKVEAAFEFLD----IF---LEGQDYVAGSQLTVADIAILSS----VSTFEVVE 170
                     |.|.|:|.|..:|    :|   |....:||...:::.|:....|    ::|....|
Yeast   113 LSFKGLIPYNKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPE 177

  Fly   171 FDISKYPNVARWY 183
            :. :|:|::.||:
Yeast   178 WR-AKHPHLMRWF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 47/208 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/68 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/125 (21%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 20/69 (29%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 22/104 (21%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.