DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and YGR201C

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:55/222 - (24%)
Similarity:89/222 - (40%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTIIMVAKALGLELNKKQLRITEGEHL-KPEFLKLNPQHTIPTLV--DNGFAIWESRAIAVYLV- 73
            |||:.......|:|:.|....::.:.| :.||    |....||.|  .:.:.:.|:.||..||: 
Yeast    17 RTIVPRGLVRSLKLDVKLADPSDAQQLYEREF----PLRKYPTFVGPHDEWTLTEAMAIDYYLIH 77

  Fly    74 ---EKYGKDDSLFP-NDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAF 134
               :|......|.| .|.:.||.|.:..........:...:.::|.|..... ||..:|   ||.
Yeast    78 LSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVKPY-NATEFK---AAR 138

  Fly   135 EFLDIF-------LEGQDY-VAGSQLTVADIAILSSVSTFEVVEFD---ISKYPNVARWYANAKK 188
            |.:|..       |:.|.| |.....|:||:...::.|...:..||   .||:|.|.||:....|
Yeast   139 ENVDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAFSLGFISFFDETWRSKHPEVTRWFNRVIK 203

  Fly   189 ITPGWDENWKGLLQMKTMYEAQKASLK 215
                 ...::|..:...|.|.:...:|
Yeast   204 -----SRFFEGEFESFKMCETEMQPIK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 50/189 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/67 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/126 (24%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 18/64 (28%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.