DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and AT1G77290

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001031292.1 Gene:AT1G77290 / 844065 AraportID:AT1G77290 Length:266 Species:Arabidopsis thaliana


Alignment Length:250 Identity:51/250 - (20%)
Similarity:100/250 - (40%) Gaps:57/250 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            |..|:.|.|..|:.:.:..:..|::.....:....|:|:.|.|.::||...:|...:....|.::
plant     1 MQLYHHPYSIDSQRVRLALEEKGIDYTSYHVNPITGKHMDPSFFRMNPNAKLPVFRNGSHIILDT 65

  Fly    66 RAIAVYLVE----KYGKDDSLFPNDPQKRALIN--------QRLYFDMGTLHDSFMKYYYPFIRT 118
            ..|..||..    ..|.:|:.|     .|.::.        :...|.:..:.|:...|...|:|.
plant    66 IEIIEYLERIAEVSSGIEDATF-----NREVVEWMRKIREWESKLFTLAHIPDNRRLYVSKFLRM 125

  Fly   119 GQLGN-AEN-------YKKVEAAFEFLDIF-----------------------LEGQDYVAGSQL 152
            ..:.. ||:       ::|:..|::..|..                       |||..|:||::.
plant   126 VVIARMAESPDLASAYHRKLREAYDTEDKLKDPGALRRSKDHLLRLLDEVETKLEGTTYLAGNEF 190

  Fly   153 TVAD---IAILSSVSTFEVVEFDISKYPNVARWYA------NAKKITPGWDENWK 198
            ::||   |.:|:.:|..::.|..||...|:|.::|      :.||:...:...|:
plant   191 SMADVMLIPVLARLSLLDLEEEYISSRKNLAEYWALVRRRPSYKKVIGRYFNGWR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 47/228 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/72 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/158 (20%)
AT1G77290NP_001031292.1 GstA 1..236 CDD:223698 49/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.