Sequence 1: | NP_524913.1 | Gene: | GstD4 / 48337 | FlyBaseID: | FBgn0010040 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_176178.1 | Gene: | GSTU16 / 842261 | AraportID: | AT1G59700 | Length: | 234 | Species: | Arabidopsis thaliana |
Alignment Length: | 198 | Identity: | 50/198 - (25%) |
---|---|---|---|
Similarity: | 85/198 - (42%) | Gaps: | 33/198 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQH-TIPTLVDNGFAIWESRA 67
Fly 68 IAVYLVEKYGKD-DSLFPNDPQKRALINQRLYFDMGTLHDSFM-KYYYPFIRTGQLGNAENYKK- 129
Fly 130 -----VEAAFEFLDIFL---EGQDYVAGSQLTVADIAILSSVSTFEVVE-------FDISKYPNV 179
Fly 180 ARW 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD4 | NP_524913.1 | PRK10542 | 1..184 | CDD:182533 | 50/198 (25%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 21/70 (30%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 25/112 (22%) | ||
GSTU16 | NP_176178.1 | GST_N_Tau | 7..81 | CDD:239356 | 22/72 (31%) |
GST_C_Tau | 93..223 | CDD:198294 | 26/113 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |