DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and clic3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:166 Identity:42/166 - (25%)
Similarity:64/166 - (38%) Gaps:40/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEFLK-LNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTL 104
            ||.|| |.|....|.|:.||....::..|..:|      :|:|.|  ||...|..:  |.:..|.
Zfish    51 PEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFL------EDTLAP--PQYPKLCCR--YKESNTA 105

  Fly   105 HDSFMKYYYPFIRTGQLG-NAENYKKVEAAFEFLDIFL----------------EGQDYVAGSQL 152
            .|.....:..:|:....| |....||...:...||.:|                ..:.|:.|:.|
Zfish   106 GDDIFHKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNAL 170

  Fly   153 TVADIAILSSVSTFEVV-----EFDI-------SKY 176
            ::||..:|..:...:||     .|:|       |||
Zfish   171 SLADCNLLPKLHIVKVVCKKYRGFEIPAELKGLSKY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 42/166 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 12/33 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/118 (22%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 16/48 (33%)
O-ClC 6..237 CDD:129941 42/166 (25%)
GST_C_CLIC3 99..231 CDD:198332 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.