DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTU13

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_174033.1 Gene:GSTU13 / 839602 AraportID:AT1G27130 Length:227 Species:Arabidopsis thaliana


Alignment Length:231 Identity:53/231 - (22%)
Similarity:87/231 - (37%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPE---FLKLNPQH-TIPTLVDNGFAIWESR 66
            ||.|..:|.      ||.|:..|.:. :.|.:.||.:   .||.||.| .:|.|:....:|.||.
plant    15 SPYSLRARV------ALHLKSVKYEY-LDEPDVLKEKSELLLKSNPIHKKVPVLLHGDLSISESL 72

  Fly    67 AIAVYLVEKYGKDDSLFPNDPQKRA-------LINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNA 124
            .:..|:.|.:....|:.|:|...||       .|:.:.:..:..:                :|..
plant    73 NVVQYVDEAWPSVPSILPSDAYDRASARFWAQYIDDKCFAAVDAV----------------VGAK 121

  Fly   125 ENYKKVEAA---FEFLDIFLE-------GQDYVAGSQLTVADIAILSSVSTFEVVE-FDISKYPN 178
            ::..|:.|.   .|.|.|..|       |..:..|..:...|||..:.:....|:| |...|:..
plant   122 DDEGKMAAVGKLMECLAILEETFQKSSKGLGFFGGETIGYLDIACSALLGPISVIEAFSGVKFLR 186

  Fly   179 VARWYANAKKITPG---WDENWKGLLQMKTMYEAQK 211
                    ::.|||   |.|.::.       :||.|
plant   187 --------QETTPGLIKWAERFRA-------HEAVK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 45/199 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/71 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/136 (18%)
GSTU13NP_174033.1 GST_N_Tau 7..82 CDD:239356 23/73 (32%)
GstA 8..219 CDD:223698 53/231 (23%)
GST_C_Tau 93..222 CDD:198294 27/146 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.