DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTF7

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:209 Identity:47/209 - (22%)
Similarity:85/209 - (40%) Gaps:36/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVY 71
            |.|:.:|.:::......|:.....:.:.:|||.|..|:..||...:|...|..|.::|||||..|
plant    10 PASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQY 74

  Fly    72 LVEKYGKDD----SLFPNDPQKRAL---INQRLYFDMGT--LHDSFMKYYYPFIRTGQLGNAENY 127
            :...|....    ||...|....|:   |....:..:|:  :.:..:|..|.......:...|..
plant    75 IAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEA 139

  Fly   128 KKVEAAFEFLDIF---LEGQDYVAGSQLTVADIAILSSVSTFEVVEFDI--------SKYPNVAR 181
            |..:.    ||::   |....|:|..:.|:.|:      .|..|:::.:        .:.|:|:.
plant   140 KLAKV----LDVYEHRLGESKYLASDKFTLVDL------HTIPVIQYLLGTPTKKLFDERPHVSA 194

  Fly   182 WYA------NAKKI 189
            |.|      :|||:
plant   195 WVADITSRPSAKKV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 43/196 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/66 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/124 (19%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 20/66 (30%)
GST_C_Phi 95..209 CDD:198296 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.