DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and ERD9

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_172508.4 Gene:ERD9 / 837576 AraportID:AT1G10370 Length:227 Species:Arabidopsis thaliana


Alignment Length:212 Identity:52/212 - (24%)
Similarity:80/212 - (37%) Gaps:54/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LELNKKQLRITEGEHLKPEF-------LKLNPQH-TIPTLVDNGFAIWESRAIAVYLVEKYGKD- 79
            :.||.|.:..   |.|:..|       ||.||.| .||.|:.....:.||..|..|:.:.:... 
plant    22 IALNLKSVPY---EFLQETFGSKSELLLKSNPVHKKIPVLLHADKPVSESNIIVEYIDDTWSSSG 83

  Fly    80 DSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLE-- 142
            .|:.|:||..||:..    |....:.:.:......|::.   |..|..|.|.|..|..:.|||  
plant    84 PSILPSDPYDRAMAR----FWAAYIDEKWFVALRGFLKA---GGEEEKKAVIAQLEEGNAFLEKA 141

  Fly   143 ------GQDYVAGSQLTVADIAILSSVSTFEVVEFDIS-------KYPNVARWYAN--------- 185
                  |:.:..|..:...|||:...::...|.|..:|       |.|::::|..|         
plant   142 FIDCSKGKPFFNGDNIGYLDIALGCFLAWLRVTELAVSYKILDEAKTPSLSKWAENFCNDPAVKP 206

  Fly   186 -----------AKKITP 191
                       ||||.|
plant   207 VMPETAKLAEFAKKIFP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 46/183 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/57 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/139 (22%)
ERD9NP_172508.4 GST_N_Tau 6..79 CDD:239356 18/59 (31%)
GST_C_Tau 91..221 CDD:198294 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.