DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Clic4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:159 Identity:38/159 - (23%)
Similarity:64/159 - (40%) Gaps:49/159 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEK---YGKDDSLFPNDPQKRALIN--QRLYFD 100
            |::|||:|:|.            ||....:.:..|   |.|:.....|:..:|.|:.  |:|   
  Rat   102 PKYLKLSPKHP------------ESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKL--- 151

  Fly   101 MGTLHDSFMKYYYPFIRTGQL--GNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSV 163
                 |.::....|    |::  .:.|:.|  .:...|||          |.::|:||..:|..:
  Rat   152 -----DEYLNSPLP----GEIDENSMEDIK--SSTRRFLD----------GDEMTLADCNLLPKL 195

  Fly   164 STFEVV-----EFDISK-YPNVARWYANA 186
            ...:||     .|||.| ...:.|:..||
  Rat   196 HIVKVVAKKYRNFDIPKGMTGIWRYLTNA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 36/155 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 8/32 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/109 (24%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101
GST_N_CLIC 14..104 CDD:239359 1/1 (100%)
O-ClC 17..252 CDD:129941 38/159 (24%)
GST_C_family 111..251 CDD:295467 33/150 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.