DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTT2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:225 Identity:56/225 - (24%)
Similarity:102/225 - (45%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |....|..||.:::..|...::.::..:.:.:.:.|.|||.::||...:|.:||....::||.||
plant     6 YADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFESHAI 70

  Fly    69 AVYLVEKYGK-DDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEA 132
            .:||...|.. .|..:|||..|||.|:..|.:....|......|....:....||...|.|....
plant    71 LIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPKAAAE 135

  Fly   133 AFEFL--------DIFLEG--QDYVAGSQLTVADIAILSSVSTFEVVEFD-----ISKYPNVARW 182
            |...|        ..:|:|  :..:.|.|.::||::::..:...:|::..     :|.:..|.:|
plant   136 AENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRLLSPHKKVEQW 200

  Fly   183 YANAKKIT-PGWDENWKGLLQMKTMYEAQK 211
            ..:.:|.| |..||..:.|.:.|..::.|:
plant   201 IESTRKATMPHSDEVHEVLFRAKDRFQKQR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 48/195 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/69 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/131 (22%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 20/71 (28%)
GST_C_Theta 92..221 CDD:198292 29/128 (23%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.