DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTT1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:225 Identity:59/225 - (26%)
Similarity:106/225 - (47%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |....|..||.:|:..|..|::.::..:.:.:.:.|.|||..:||...:|.:||....::||.||
plant     7 YADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFESHAI 71

  Fly    69 AVYLVEKY-GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEA 132
            .:||...: ...|..:|||..|||.|:..|.:....|......|....:....||...|.|....
plant    72 LIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPLNPKAAAE 136

  Fly   133 AFEFL--------DIFLEGQ-DYVAGS-QLTVADIAILSSVSTFEVVEFD-----ISKYPNVARW 182
            |.:.|        ..:|:|. .::.|| |.::||::::..:...:|::..     :|.:..|.:|
plant   137 AEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLSTHKKVEQW 201

  Fly   183 YANAKKIT-PGWDENWKGLLQMKTMYEAQK 211
            ..|.||.| |.:||..:.|.::|..::.::
plant   202 IENTKKATMPHFDETHEILFKVKEGFQKRR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 50/195 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/131 (24%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 22/71 (31%)
GST_C_Theta 93..223 CDD:198292 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.