DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTF12

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:205 Identity:48/205 - (23%)
Similarity:86/205 - (41%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYG-KDDSLFPND 86
            |:|.....:.:...|..|||.|...|...:|.:.|..|.::||||||.|...|:. :..:|....
plant    25 GIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQGTNLLGKS 89

  Fly    87 PQKRALINQRLYFDMGTLHDSFMKYYY-----PFI-------RTGQLGN---AENYK-KVEAAFE 135
            .:.||:::|  :.|:.|       ||:     |.:       |.|:..:   .|:.| |:....:
plant    90 LEHRAIVDQ--WADVET-------YYFNVLAQPLVINLIIKPRLGEKCDVVLVEDLKVKLGVVLD 145

  Fly   136 FLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVA----RWYANAKKITPGWDE- 195
            ..:..|....::||.:.|:||:..:.::.....:. ||::.....    ||          |:| 
plant   146 IYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSIT-DINQMVKARGSFNRW----------WEEI 199

  Fly   196 ----NWKGLL 201
                :||.|:
plant   200 SDRPSWKKLM 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 43/181 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/50 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/139 (20%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 48/205 (23%)
GST_N_Phi 2..77 CDD:239351 18/51 (35%)
GST_C_Phi 91..209 CDD:198296 27/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.