DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and DHAR3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_568336.1 Gene:DHAR3 / 831532 AraportID:AT5G16710 Length:258 Species:Arabidopsis thaliana


Alignment Length:140 Identity:27/140 - (19%)
Similarity:61/140 - (43%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPE-FLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGT 103
            ||| |||::|:..:|.:..:...:.:|..|...|.|||.:.....|  |:| |.:..:::     
plant    93 KPEWFLKISPEGKVPVVKFDEKWVPDSDVITQALEEKYPEPPLATP--PEK-ASVGSKIF----- 149

  Fly   104 LHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEV 168
                  ..:..|:::...|:......::....|.|...:...::.|.:::.||:::...:...::
plant   150 ------STFVGFLKSKDSGDGTEQVLLDELTTFNDYIKDNGPFINGEKISAADLSLAPKLYHMKI 208

  Fly   169 VEFDISKYPN 178
            .   :..|.|
plant   209 A---LGHYKN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 27/140 (19%)
GST_N_Delta_Epsilon 1..74 CDD:239343 11/34 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 11/91 (12%)
DHAR3NP_568336.1 PLN02817 3..258 CDD:166458 27/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.