DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:212 Identity:59/212 - (27%)
Similarity:95/212 - (44%) Gaps:37/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GSRTIIMVAKALGLELNKKQLRITEGE----------HLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            |......||:.| |.|::|.   ||.|          |..|.||.:||...:|.|.|:...::||
plant     7 GDEMSACVARVL-LCLHEKN---TEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFES 67

  Fly    66 RAIAVYLVEKYGKD---DSLFPNDPQKRALINQRLYFDMGTLH--DSFMKYYYPFIRTGQLGNAE 125
            |||..|:.||: :|   |.....||::.|::  :|:.::...|  .:.....:..|.....|.:.
plant    68 RAITAYIAEKH-RDKGTDLTRHEDPKEAAIV--KLWSEVEAHHFNPAISAVIHQLIVVPLQGESP 129

  Fly   126 NYKKVEAAFE----FLDIFLE--GQ-DYVAGSQLTVADIAILSSVSTF-EVVEFD-ISKYPNVAR 181
            |...||...|    .||::.|  |: .|:||...|:||:..:.....| :.:... |:..|||..
plant   130 NAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGLINDRPNVKA 194

  Fly   182 WYANA------KKITPG 192
            |:.:.      .|::||
plant   195 WWEDLCSRPAFLKVSPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 56/196 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/122 (23%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 57/208 (27%)
GST_N_Phi 2..77 CDD:239351 25/73 (34%)
GST_C_Phi 92..208 CDD:198296 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.