DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTF11

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:230 Identity:48/230 - (20%)
Similarity:97/230 - (42%) Gaps:54/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |...:::..:.:::......:|.....:.:.:.|..||:.|...|...:|.:.|....::|||||
plant     6 YGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAI 70

  Fly    69 AVYLVEKY---GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYY----PFI-------RTG 119
            |.|...||   |.|  |.....:.||:::|.:..:        ..|:|    |.:       ::|
plant    71 ARYYATKYADQGTD--LLGKTLEGRAIVDQWVEVE--------NNYFYAVALPLVMNVVFKPKSG 125

  Fly   120 QLGNAENYKKVEAAFE-FLDIF---LEGQDYVAGSQLTVADIA-------ILSSVSTFEVVEFDI 173
            :..:....::::..|: .||::   |....|:.|.:.|:||::       |::..|...:|    
plant   126 KPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLV---- 186

  Fly   174 SKYPNVARWYANAKKITPGWDE-----NWKGLLQM 203
            :...|:.||          |:|     .||.|:::
plant   187 TSRENLNRW----------WNEISARPAWKKLMEL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 43/204 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/69 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/143 (19%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 48/230 (21%)
GST_N_Phi 2..77 CDD:239351 16/70 (23%)
GST_C_Phi 91..209 CDD:198296 26/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.