DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTF8

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:219 Identity:61/219 - (27%)
Similarity:94/219 - (42%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SSGSRTIIMVA-KALGLELNKKQLRI------------------TEGEHLKPEFLKLNPQHTIPT 54
            ||.|.:|||.: |..|:.::...:|:                  ..|.|.:...|.|||...||.
plant    41 SSSSSSIIMASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPA 105

  Fly    55 LVDNGFAIWESRAIAVYLVEKYG-KDDSLFPNDPQK-RALINQRLYFDMGTLHDSFMKYYYPFIR 117
            |.|....::|||||..||.|:|. |.:.|...|.:| :|..|..|..:......:..|..:..:.
plant   106 LEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVF 170

  Fly   118 TGQLGNAEN---YKKVEAAFE-FLDIF---LEGQDYVAGSQLTVADI----AILSSVSTFEVVEF 171
            .|..|...:   .:::|...: .||::   |...:::||...|:||:    ||...:.|...|.|
plant   171 KGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLF 235

  Fly   172 DISKYPNVARWYANAKKIT--PGW 193
            |  ..|.|:.|   .|||:  |.|
plant   236 D--SRPKVSEW---IKKISARPAW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 56/206 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 26/83 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/120 (25%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.