DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTF10

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:209 Identity:55/209 - (26%)
Similarity:93/209 - (44%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIA 69
            |:|..:.|:..::.....|:......:.:.:||..:||:|.:.|...||.|||..:.|:|||||.
plant     6 YAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIM 70

  Fly    70 VYLVEKY---GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKV- 130
            .|:.|||   |.|  |.....::|..:.|.|..:..:.|...:......:....:|...:.|.: 
plant    71 RYIAEKYRSQGPD--LLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIK 133

  Fly   131 ---EAAFEFLDIF---LEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKI 189
               |...|.||::   |...:|:||..:::||:|.|...   |.:...|.|    |....:.|.:
plant   134 ESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFT---EYLVGPIGK----AHLIKDRKHV 191

  Fly   190 TPGWDE-----NWK 198
            :..||:     .||
plant   192 SAWWDKISSRAAWK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 50/188 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/68 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/123 (22%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 55/209 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.