DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GSTU4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_180507.1 Gene:GSTU4 / 817495 AraportID:AT2G29460 Length:224 Species:Arabidopsis thaliana


Alignment Length:235 Identity:55/235 - (23%)
Similarity:103/235 - (43%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQH-TIPTLVDNGFAIWE 64
            :.|:.||   .:|.:.|..|..|:.....:..|.   :..|..|::||.: .:|.||..|..:.|
plant    11 LGFWASP---FTRRVEMAFKLKGVPYEYLEQDIV---NKSPLLLQINPVYKKVPVLVYKGKILSE 69

  Fly    65 SRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYF------DMGTLHDSFMKYYYPFIRTGQLGN 123
            |..|..| :::..|::.:.|.||.::|:   .|::      .:|.:  :||.     :...:.|.
plant    70 SHVILEY-IDQIWKNNPILPQDPYEKAM---ALFWAKFVDEQVGPV--AFMS-----VAKAEKGV 123

  Fly   124 AENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTF------EVVEFDI---SKYPNV 179
            ....|:.:..|.||:..:.|:|:..|..:...|: :..|:..|      |.:..|:   .|:|.:
plant   124 EVAIKEAQELFMFLEKEVTGKDFFGGKTIGFLDL-VAGSMIPFCLARGWEGMGIDMIPEEKFPEL 187

  Fly   180 ARWYANAKKI------TPGWDENWKGLLQMKTMYEAQKAS 213
            .||..|.|:|      .|..:|.   :..||.:.|..|::
plant   188 NRWIKNLKEIEIVRECIPPREEQ---IEHMKKVVERIKSA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 46/198 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/73 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/136 (20%)
GSTU4NP_180507.1 GST_N_Tau 8..81 CDD:239356 20/76 (26%)
GstA 9..197 CDD:223698 48/203 (24%)
GST_C_Tau 91..216 CDD:198294 29/138 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.