DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:280 Identity:56/280 - (20%)
Similarity:96/280 - (34%) Gaps:98/280 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |:..:|..|:.:.:|....||...::.:.:.:.||.:|.|::||....:|.::.....|.:...|
Human    50 YHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQI 114

  Fly    69 AVYLVEKY-----GKDDSLFPNDP------------------------QKRALINQRLYFDMGT- 103
            ..|:...:     |:..|.||..|                        |.|.|:: .|..|..| 
Human   115 IDYVERTFTGGGRGRCPSGFPAQPLAVPTEHVVALMPEVGSLQHARVLQYRELLD-ALPMDAYTH 178

  Fly   104 ---LH-----DSFM-KYYYPFIRTGQLGNA----------------ENY---------------- 127
               ||     ||.: ||....||. .|.||                |.|                
Human   179 GCILHPELTTDSMIPKYATAEIRR-HLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDD 242

  Fly   128 ----KK-----------VEAAFEFLDIFLEGQD---YVAGSQLTVADIAILSSVSTFEVVEFDIS 174
                ||           :||..|...:..|||.   ::.|...|:||:.:.:::...:.:... .
Human   243 VSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLS-K 306

  Fly   175 KY------PNVARWYANAKK 188
            ||      ||:..::...::
Human   307 KYWEDGSRPNLQSFFERVQR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 56/274 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/69 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 35/167 (21%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 56/280 (20%)
GST_N_GDAP1 47..119 CDD:239350 16/68 (24%)
GST_C_GDAP1L1 220..330 CDD:198335 18/108 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.