Sequence 1: | NP_524913.1 | Gene: | GstD4 / 48337 | FlyBaseID: | FBgn0010040 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243666.1 | Gene: | GDAP1L1 / 78997 | HGNCID: | 4213 | Length: | 386 | Species: | Homo sapiens |
Alignment Length: | 280 | Identity: | 56/280 - (20%) |
---|---|---|---|
Similarity: | 96/280 - (34%) | Gaps: | 98/280 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
Fly 69 AVYLVEKY-----GKDDSLFPNDP------------------------QKRALINQRLYFDMGT- 103
Fly 104 ---LH-----DSFM-KYYYPFIRTGQLGNA----------------ENY---------------- 127
Fly 128 ----KK-----------VEAAFEFLDIFLEGQD---YVAGSQLTVADIAILSSVSTFEVVEFDIS 174
Fly 175 KY------PNVARWYANAKK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD4 | NP_524913.1 | PRK10542 | 1..184 | CDD:182533 | 56/274 (20%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 16/69 (23%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 35/167 (21%) | ||
GDAP1L1 | NP_001243666.1 | GstA | 47..333 | CDD:223698 | 56/280 (20%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | 16/68 (24%) | ||
GST_C_GDAP1L1 | 220..330 | CDD:198335 | 18/108 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154477 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |