DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Clic3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:142 Identity:29/142 - (20%)
Similarity:53/142 - (37%) Gaps:33/142 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDD--SLFPNDPQKRALINQRLYFDMGTLHDSFMK 110
            |...:|.|:.:|....::..|..:|.|..|..|  ||.|.            |.:..|..:....
Mouse    90 PGSQLPILLYDGDVKTDTLQIEEFLEETLGPPDFPSLAPR------------YRESNTAGNDIFH 142

  Fly   111 YYYPFIRTGQLGNAEN--YKKVEAAFEFLDIFLEG----------------QDYVAGSQLTVADI 157
            .:..||: ..:...:|  |:::..|...||.:|..                :.::.|.|.|:||.
Mouse   143 KFSAFIK-NPVPTQDNALYQQLLRALTRLDSYLRAPLDHELAQEPHLRESHRRFLDGDQFTLADC 206

  Fly   158 AILSSVSTFEVV 169
            ::|..:...:.|
Mouse   207 SLLPKLHIVDTV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 29/142 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 6/25 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 17/100 (17%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.