DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GstD10

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:209 Identity:130/209 - (62%)
Similarity:159/209 - (76%) Gaps:1/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEG-EHLKPEFLKLNPQHTIPTLVDNGFAIWE 64
            ||.||.|.|:..|:::|.|||||:|.:||.:..|.. |...||:||:|||||||||.|:|||:||
  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

  Fly    65 SRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKK 129
            ||||.|||||||||||.|||.|.||:||||||||||||||:.||.:||||.|...:..|.|||||
  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKK 130

  Fly   130 VEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWD 194
            :|.|||||:.|||||.|.||...::||||.|::||||:|..||..:|.||||||.||||:||||:
  Fly   131 IEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWE 195

  Fly   195 ENWKGLLQMKTMYE 208
            |||.|..:.:..::
  Fly   196 ENWAGCQEFRKYFD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 117/183 (64%)
GST_N_Delta_Epsilon 1..74 CDD:239343 44/73 (60%)
GST_C_Delta_Epsilon 88..204 CDD:198287 74/115 (64%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 44/73 (60%)
PLN02473 3..196 CDD:166114 124/192 (65%)
GST_C_Delta_Epsilon 89..205 CDD:198287 74/115 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468483
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.