DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gstm3l

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_065415.1 Gene:Gstm3l / 57298 RGDID:620381 Length:218 Species:Rattus norvegicus


Alignment Length:147 Identity:28/147 - (19%)
Similarity:58/147 - (39%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPTLVDNGFAIWESRAIAVYLVEKYG----KDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYY 112
            :|.|:|....:.:|.||..||..|:.    .::.....|..:..:::.|::..:......|.|..
  Rat    60 LPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIHLMIVCCSPDFEKQK 124

  Fly   113 YPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFD-ISKY 176
            ..|:           |.:....:....||..:.:.||.::|..|......:..:.:.|.: :..:
  Rat   125 PEFL-----------KSIPEKMKIYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPECLDAF 178

  Fly   177 PNVARWYA---NAKKIT 190
            ||:..:.|   ..|||:
  Rat   179 PNLKDFLARFEGLKKIS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 24/136 (18%)
GST_N_Delta_Epsilon 1..74 CDD:239343 8/21 (38%)
GST_C_Delta_Epsilon 88..204 CDD:198287 18/107 (17%)
Gstm3lNP_065415.1 PTZ00057 3..203 CDD:173353 28/147 (19%)
GST_N_Mu 3..84 CDD:239373 8/23 (35%)
GST_C_Mu 92..212 CDD:198318 19/115 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.