DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and eef1e1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:136 Identity:39/136 - (28%)
Similarity:65/136 - (47%) Gaps:24/136 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPTLV-DNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPF 115
            :|.|. :||.|:.....||.:|| |..|...|..:|.::||::.|.|..                
Zfish    29 VPVLQNNNGPALTGLVTIACHLV-KEAKRPELLGDDAEQRAVVQQWLEH---------------- 76

  Fly   116 IRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISK---YP 177
             |..:|.|... ::|:...:.|:.:||.:.|:||:..|:|||.:...:... :||..|.:   |.
Zfish    77 -RITKLDNCSK-EEVKVILKDLNRYLEDKVYLAGNVFTLADILMYYGIHHI-IVELAIQEKECYL 138

  Fly   178 NVARWY 183
            ||:||:
Zfish   139 NVSRWF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 39/136 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 8/22 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/99 (26%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.