DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gstr

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:196 Identity:48/196 - (24%)
Similarity:85/196 - (43%) Gaps:21/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LGLELNKKQLR--------ITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKY-G 77
            |.:.|.:|||:        ..:.||..||...|||:..:||.......:.||.|..:||...: .
Zfish    19 LMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNESFAACLYLESVFKS 83

  Fly    78 KDDSLFPNDPQKRALINQRLYFDMGTLHDSF--MKYYYPFIRTGQ-LGNA--ENYKKVEAAFEFL 137
            :...|.|::|.:.||:.||: |:...|....  :.:|...:..|: |.:|  .|.:|:....:..
Zfish    84 QGTRLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWLVPEGERLESALKRNKEKLIEELKLW 147

  Fly   138 DIFLEGQ---DYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAK---KITPGWDEN 196
            :.:||..   .|:||...::||:.....::.|..::....:.|.:..:|...|   .|...|...
Zfish   148 EGYLEKMGKGSYLAGKNFSMADVVCFPVIAYFPRLQCPKERCPRLMEYYEMVKDRPSIKASWPPE 212

  Fly   197 W 197
            |
Zfish   213 W 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 43/178 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/59 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/121 (21%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 46/188 (24%)
GST_N_family 5..78 CDD:238319 18/58 (31%)
GST_C_family 99..199 CDD:198286 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.