DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gdap1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:275 Identity:55/275 - (20%)
Similarity:100/275 - (36%) Gaps:91/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |:..:|..|:.:.:.....||:.....:.:...||.:|.|::|||...:|.||.:...|.:...|
Zfish    43 YHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICDPTQI 107

  Fly    69 AVYLVEKYGKDDS--LFPND--------PQKRALINQRLYFDMGT----LH-----DSFM-KYYY 113
            ..||.:.:..:.:  |.|.:        ...|.|::. |..|..|    ||     ||.: .|..
Zfish   108 MDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDS-LQMDAYTHGCILHPEITVDSHIPAYAT 171

  Fly   114 PFIRTGQLGNAE--------------------------------NYKKVEAAFEFLDIFL----- 141
            ..||| |:||.|                                |.|.::...:.|:..|     
Zfish   172 THIRT-QIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVLDQVET 235

  Fly   142 -----------EG--QDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGW 193
                       ||  |.::.|...::||:::  :|:...:....:|:     |::.|..::    
Zfish   236 ELQRRSEETPEEGSQQAWLCGDFFSIADVSL--AVTLHRLKFLGLSR-----RYWGNGMRV---- 289

  Fly   194 DENWKGLLQMKTMYE 208
                    .::|.||
Zfish   290 --------NLETYYE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 51/249 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 19/69 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/175 (18%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 55/275 (20%)
GST_N_GDAP1 40..112 CDD:239350 18/68 (26%)
GST_C_family 193..304 CDD:295467 17/123 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.