DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GDAP1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens


Alignment Length:270 Identity:53/270 - (19%)
Similarity:96/270 - (35%) Gaps:78/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68
            |:...|..|:.:.:|.....|:..:..:.:...||.:|.|::||....:|.|:.....|.|:..|
Human    29 YHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQI 93

  Fly    69 AVYLVEKY----------GKDDSLFPNDPQKRALINQRLYFDMGT----LH-----DSFMKYYYP 114
            ..||.:.:          .|:...:|.....|.|::. |..|..|    ||     ||.:..|..
Human    94 IDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDS-LPMDAYTHGCILHPELTVDSMIPAYAT 157

  Fly   115 FIRTGQLGNAE--------------------------------NYKKVEAAFEFLDIFL------ 141
            .....|:||.|                                |.|.::...:.|:..|      
Human   158 TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETE 222

  Fly   142 ----------EGQD-YVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDE 195
                      |||. ::.|...|:||:::..::...:.:.|       ..|.:.|.|:  |..:.
Human   223 LQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGF-------ARRNWGNGKR--PNLET 278

  Fly   196 NWKGLLQMKT 205
            .::.:|:.||
Human   279 YYERVLKRKT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 47/247 (19%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/69 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/173 (18%)
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 17/68 (25%)
GST_C_GDAP1 179..289 CDD:198336 19/119 (16%)
Required for mitochondrial localization 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.