DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gstm4

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001019475.1 Gene:Gstm4 / 499689 RGDID:1565825 Length:218 Species:Rattus norvegicus


Alignment Length:229 Identity:53/229 - (23%)
Similarity:84/229 - (36%) Gaps:60/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PRSSGSRTIIMVAKALGLEL-----NKKQLRITEGEHLKPEF---------LKLNPQH-TIPTLV 56
            |.:.|...|..:|.|:.|.|     :.::.|.|.|:  .|::         .||.... .:|.|:
  Rat     2 PMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGD--APDYDRSQWLSEKFKLGLDFPNLPYLI 64

  Fly    57 DNGFAIWESRAIAVYLVEKY---GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRT 118
            |....|.:|.||..|:..|:   |:.:             .:::..|:  |.:..|.......|.
  Rat    65 DGSHKITQSNAILRYIARKHNLCGETE-------------EEKIRVDI--LENQAMDVSNQLARV 114

  Fly   119 GQLGNAENYK-----KVEAAFEFLDIFLEGQDYVAGSQLTVADIA---ILSSVSTFEVVEFDISK 175
            ....:.||.|     ::....|....||..|.:..|.::|..|..   ||.....||....|  .
  Rat   115 CYSPDFENLKAEYLEQLPGMMELFSQFLGKQTWFVGEKITFVDFLAYDILDLHLIFEPKCLD--A 177

  Fly   176 YPN----VARWYANAKKITPGWDENWKGLLQMKT 205
            :||    ||| :...|||:          :.|||
  Rat   178 FPNLKDFVAR-FEGLKKIS----------VYMKT 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 47/206 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/81 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/127 (21%)
Gstm4NP_001019475.1 GST_N_Mu 3..84 CDD:239373 20/82 (24%)