DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and Gstt3

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:203 Identity:49/203 - (24%)
Similarity:86/203 - (42%) Gaps:32/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            ::.|....|...|.:.:.||..|:....:.:.:.:|:|....|.::||...:|.|.|..|.:.||
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAES 124

  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHD-----SFMKYYYPFIRTGQLGN-- 123
            .||.:||..||...|..:|.|.|.||.:::.|.:....|..     .:.|..:|..    ||.  
  Rat   125 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVF----LGQPV 185

  Fly   124 -----AENYKKVEAAFEFL-DIFLEGQDYVAGSQLTVADIAILSSV--------STFEVVEFDIS 174
                 |....:::...:.| |.||:.:.::.|..::|||:..::.:        ..||       
  Rat   186 PPERLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIFE------- 243

  Fly   175 KYPNVARW 182
            ..|.:|.|
  Rat   244 SRPKLAAW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 49/203 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/116 (20%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 21/74 (28%)
GST_C_Theta 149..273 CDD:198292 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348117
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.