DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and tm2d2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001011324.1 Gene:tm2d2 / 496785 XenbaseID:XB-GENE-964283 Length:198 Species:Xenopus tropicalis


Alignment Length:42 Identity:12/42 - (28%)
Similarity:19/42 - (45%) Gaps:11/42 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HLKPEFLKLNP--QHTIPTLVDNGFAIWESRAIAVYLVEKYG 77
            :|..||::.:.  .|     :.||.|..|.|    |..:|:|
 Frog    59 YLPEEFVECDDPVDH-----MGNGTAQQELR----YGCKKFG 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 12/42 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 10/37 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287
tm2d2NP_001011324.1 TM2 130..179 CDD:377473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.