powered by:
Protein Alignment GstD4 and tm2d2
DIOPT Version :9
Sequence 1: | NP_524913.1 |
Gene: | GstD4 / 48337 |
FlyBaseID: | FBgn0010040 |
Length: | 215 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001011324.1 |
Gene: | tm2d2 / 496785 |
XenbaseID: | XB-GENE-964283 |
Length: | 198 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 12/42 - (28%) |
Similarity: | 19/42 - (45%) |
Gaps: | 11/42 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 HLKPEFLKLNP--QHTIPTLVDNGFAIWESRAIAVYLVEKYG 77
:|..||::.:. .| :.||.|..|.| |..:|:|
Frog 59 YLPEEFVECDDPVDH-----MGNGTAQQELR----YGCKKFG 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.