DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gsto1

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001011256.1 Gene:gsto1 / 496704 XenbaseID:XB-GENE-5771576 Length:241 Species:Xenopus tropicalis


Alignment Length:183 Identity:51/183 - (27%)
Similarity:85/183 - (46%) Gaps:32/183 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IIMVAKALGLELNKKQLRITEGEHLKPE-FLKLNPQHTIPTL-VDNGFAIWESRAIAVYLVEKY- 76
            :|:|||.:..||      :......||: |.:.:|...:|.: ...|..|:||:.:..||.|.: 
 Frog    39 LILVAKGIKHEL------VYINTLNKPDWFFEKSPFGQVPAIETSKGQLIYESQIVCDYLDEVFP 97

  Fly    77 GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMK-YYYPFIRTGQLGNAENYKKVEAAFEFLDIF 140
            ||  .|.|.||.::|  .|::      |.:.|.| ....|...|...|.|:...::|  |||:..
 Frog    98 GK--KLTPQDPFQKA--QQKM------LLEHFSKASTVAFKIVGAKKNNEDISALKA--EFLEKL 150

  Fly   141 LE--------GQDYVAGSQLTVADIAILSSVSTFEV--VEFDISKYPNVARWY 183
            ::        ...||.||.:::||..||.....|::  |:..:.|.|::.:||
 Frog   151 VQFDQVVAKLNTPYVGGSSVSMADYMILPIFERFDIFGVKDCLEKTPHLLQWY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 51/183 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/60 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/107 (25%)
gsto1NP_001011256.1 GST_N_Omega 6..93 CDD:239353 16/59 (27%)
GST_C_Omega 107..229 CDD:198293 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.