DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and clic5a

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:201 Identity:49/201 - (24%)
Similarity:76/201 - (37%) Gaps:40/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SRTIIMVAKALGLELNKKQLRITEGEHLKPEFL-KLNPQHTIPTLVDNGFAIWESRAIAVYLVEK 75
            |:.:.|:....|:..|...:.:..    ||..| .|.|....|.|..||....:...|..:|   
Zfish    31 SQRLFMILWLKGVVFNVTTVDLKR----KPADLHNLAPGTPPPFLTFNGEVRTDVNKIEEFL--- 88

  Fly    76 YGKDDSLFPNDPQKRALINQRLYFDMGTL-HDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDI 139
               ::.|.|....|.|..|:    :..|. :|.|.|:......|....||...|.:....:.||.
Zfish    89 ---EEMLAPPKYPKLAAKNK----ESNTAGNDIFAKFSAYIKNTKPEANASLEKGLLKVLKKLDS 146

  Fly   140 FLE------------GQD------YVAGSQLTVADIAILSSVSTFEVV-----EFDI-SKYPNVA 180
            ||.            |::      |:.|::||:||..:|..:...:||     .|:| |....|.
Zfish   147 FLNSPLPDEIDAESTGEEKSSNRKYLDGNELTLADCNLLPKLHVVKVVSKKYRNFEIPSDLSGVW 211

  Fly   181 RWYANA 186
            |:..||
Zfish   212 RYLQNA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 47/197 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/62 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/124 (26%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 17/75 (23%)
O-ClC 10..244 CDD:129941 49/201 (24%)
GST_C_CLIC5 104..244 CDD:198330 30/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.