Sequence 1: | NP_524913.1 | Gene: | GstD4 / 48337 | FlyBaseID: | FBgn0010040 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007386.1 | Gene: | clic5a / 492513 | ZFINID: | ZDB-GENE-041114-84 | Length: | 246 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 49/201 - (24%) |
---|---|---|---|
Similarity: | 76/201 - (37%) | Gaps: | 40/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 SRTIIMVAKALGLELNKKQLRITEGEHLKPEFL-KLNPQHTIPTLVDNGFAIWESRAIAVYLVEK 75
Fly 76 YGKDDSLFPNDPQKRALINQRLYFDMGTL-HDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDI 139
Fly 140 FLE------------GQD------YVAGSQLTVADIAILSSVSTFEVV-----EFDI-SKYPNVA 180
Fly 181 RWYANA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD4 | NP_524913.1 | PRK10542 | 1..184 | CDD:182533 | 47/197 (24%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 15/62 (24%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 32/124 (26%) | ||
clic5a | NP_001007386.1 | GST_N_CLIC | 8..97 | CDD:239359 | 17/75 (23%) |
O-ClC | 10..244 | CDD:129941 | 49/201 (24%) | ||
GST_C_CLIC5 | 104..244 | CDD:198330 | 30/118 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589654 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |