DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gsto2

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:155 Identity:45/155 - (29%)
Similarity:71/155 - (45%) Gaps:22/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPE-FLKLNPQHTIPTL-VDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMG 102
            ||: |||.||..|:|.| ..:|..|:||.....||.|.| .:..|.|:||.:||  .|::..:  
Zfish    58 KPDWFLKKNPFGTVPVLETSSGQVIYESPITCEYLDEVY-PEKKLLPSDPFERA--QQKMLLE-- 117

  Fly   103 TLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQD--------YVAGSQLTVADIAI 159
             |:...:.|:|......:.|  |:....||  ||.:..|:..:        |..|..:|:.|..|
Zfish   118 -LYSKVIPYFYKISMGKKRG--EDVSTAEA--EFTEKLLQLNEALANKKTKYFGGDSITMIDYLI 177

  Fly   160 LSSVSTFEV--VEFDISKYPNVARW 182
            .......|:  |:..::|.|.:.:|
Zfish   178 WPWFERAEMMGVKHCLAKTPELRKW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 45/155 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/35 (46%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/105 (22%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 15/34 (44%)
GstA 25..210 CDD:223698 45/155 (29%)
GST_C_Omega 107..229 CDD:198293 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.