DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:187 Identity:51/187 - (27%)
Similarity:88/187 - (47%) Gaps:24/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KAL-GLELNKKQLRITE----GEHLK-PEFLKLNPQHTIPTL-VDNGFAIWESRAIAVYLVEKY- 76
            ||| ..:.:..|:::.:    ||..| .||||..|...:|.. ...|..:.||.|||..|..:. 
  Fly    17 KALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQL 81

  Fly    77 --GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIR-TGQLGNAENYKKVEAAFEFLD 138
              ||       .|..:|.:.|.:.|....:..:...:.:|.:. ..|..|:...::.||..:.|:
  Fly    82 RGGK-------CPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLN 139

  Fly   139 IFLEGQDYVAGSQLTVADIAILSS-VSTFE-VVEFDI-SKYPNVARWYA---NAKKI 189
            ..|:...::||.::|:|||.:.|| :..:| |:|..: |.:.||.||:.   |.|::
  Fly   140 QKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 49/177 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/60 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/109 (26%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 20/61 (33%)
GstA 5..187 CDD:223698 48/176 (27%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 28/107 (26%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.