DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and GluProRS

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_524471.2 Gene:GluProRS / 42834 FlyBaseID:FBgn0005674 Length:1714 Species:Drosophila melanogaster


Alignment Length:243 Identity:53/243 - (21%)
Similarity:86/243 - (35%) Gaps:71/243 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTII---MVAKALGLELNKKQLRITEGEHLKPEFLK--------------LNP 48
            :|.:..||....|.||   |..:.|      |:..|.:|......|:.              :.|
  Fly   453 VDGWDDPRFPTVRGIIRRGMTVEGL------KEFIIAQGSSKSVVFMNWDKIWAFNKKVIDPIAP 511

  Fly    49 QHTIPTLVDNGFAIWESRAIAVYL---------VEKYGKDDSLFPNDPQKRALINQRLYFDMGTL 104
            ::|         |:.:.:.:.|.:         |..:.||:||    .:|..|:..|:|.|....
  Fly   512 RYT---------ALEKEKRVIVNVAGAKVERIQVSVHPKDESL----GKKTVLLGPRIYIDYVDA 563

  Fly   105 -------HDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSS 162
                   :.:|:.:....||......:.|...|:||..     ||.:|:....:|          
  Fly   564 EALKEGENATFINWGNILIRKVNKDASGNITSVDAALN-----LENKDFKKTLKL---------- 613

  Fly   163 VSTFEVVEFDISKYPNVARWYAN--AKKITPGWDENWKGLLQMKTMYE 208
              |:..||.|.|.||.....|.:  ..|...|.||::|..:..||..|
  Fly   614 --TWLAVEDDPSAYPPTFCVYFDNIISKAVLGKDEDFKQFIGHKTRDE 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 44/215 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/98 (16%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/124 (23%)
GluProRSNP_524471.2 PLN02907 1..715 CDD:215492 53/243 (22%)
GST_C_GluProRS_N 76..153 CDD:198342
tRNA-synt_1c 203..508 CDD:279135 12/60 (20%)
tRNA-synt_1c_C 510..688 CDD:281883 41/180 (23%)
WHEP-TRS 748..799 CDD:278865
WHEP-TRS 821..870 CDD:278865
WHEP-TRS 894..945 CDD:278865
WEPRS_RNA 973..1022 CDD:238473
WHEP-TRS 1050..1100 CDD:278865
WHEP-TRS 1122..1168 CDD:278865
PRK08661 1220..1714 CDD:236327
ProRS_core_arch_euk 1224..1486 CDD:238401
ProRS_anticodon_zinc 1492..1714 CDD:238439
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.