DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and gfzf

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:202 Identity:68/202 - (33%)
Similarity:102/202 - (50%) Gaps:13/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65
            |..|.......|..:.|..|||.::.....:.....||...|:.|:|||..||.|.|:||.:.||
  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876

  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLH-----DSFMKYYYPFIRTGQLGNAE 125
            .||..||.:||..|.:|:|.|...||:|||||.|:||..:     .|....::.:.||..     
  Fly   877 IAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPM----- 936

  Fly   126 NYKKVEAAFEFLDIFLE--GQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKK 188
            :.|||:.|.:..:.:|:  |..|.||..:|:||.|::|:....|.:.||:.::..|.:||...|.
  Fly   937 SLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYETFKV 1001

  Fly   189 ITPG-WD 194
            ..|. |:
  Fly  1002 EYPQLWE 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 64/189 (34%)
GST_N_Delta_Epsilon 1..74 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/115 (31%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 26/73 (36%)
GstA 812..1000 CDD:223698 65/192 (34%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 36/114 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.920

Return to query results.
Submit another query.