DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD4 and clic5b

DIOPT Version :9

Sequence 1:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:205 Identity:47/205 - (22%)
Similarity:70/205 - (34%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SRTIIMVAKALGLELNKKQLRITEGEHLKPEFL-KLNPQHTIPTLVDNGFAIWESRAIAVYLVE- 74
            |:.:.|:....|:..|...:.:..    ||..| .|.|....|.|..||....:...|..:|.| 
Zfish   193 SQRLFMILWLKGVVFNVTTVDLKR----KPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEEV 253

  Fly    75 ----KYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFE 135
                ||.|   |.....:..|..|           |.|.|:......|....|....|.:..|.:
Zfish   254 LAPPKYPK---LAARHRESNAAGN-----------DIFAKFSAFIKNTKPDANEALEKGLTKALK 304

  Fly   136 FLDIFL------------------EGQDYVAGSQLTVADIAILSSVSTFEVV-----EFDI-SKY 176
            .||.:|                  ..:.::.|:.||:||..:|..:...:||     .||| |..
Zfish   305 KLDEYLNSPLPDEVDADSMEEEKASNRRFLDGNDLTLADCNLLPKLHIVKVVAKKYRNFDIPSDL 369

  Fly   177 PNVARWYANA 186
            ..|.|:..:|
Zfish   370 TGVWRYLNSA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 46/201 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/62 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/123 (22%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 16/69 (23%)
O-ClC 172..407 CDD:129941 47/205 (23%)
GST_C_CLIC5 266..406 CDD:198330 27/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.